Lineage for d1bteb_ (1bte B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032361Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 3032417Protein Type II activin receptor [57357] (3 species)
  7. 3032418Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 3032420Domain d1bteb_: 1bte B: [44464]
    complexed with nag

Details for d1bteb_

PDB Entry: 1bte (more details), 1.5 Å

PDB Description: crystal structure of the extracellular domain of the type ii activin receptor
PDB Compounds: (B:) protein (activin receptor type II)

SCOPe Domain Sequences for d1bteb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bteb_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpe

SCOPe Domain Coordinates for d1bteb_:

Click to download the PDB-style file with coordinates for d1bteb_.
(The format of our PDB-style files is described here.)

Timeline for d1bteb_: