Class g: Small proteins [56992] (66 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulphide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (3 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins) |
Protein Type II activin receptor [57357] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [57358] (2 PDB entries) |
Domain d1bteb_: 1bte B: [44464] complexed with nag |
PDB Entry: 1bte (more details), 1.5 Å
SCOP Domain Sequences for d1bteb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bteb_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus)} etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc ydrtdciekkdspevyfcccegnmcnekfsyfpe
Timeline for d1bteb_: