Lineage for d1ffja_ (1ffj A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143453Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 143454Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 143455Family g.7.1.1: Snake venom toxins [57303] (22 proteins)
  6. 143503Protein Cardiotoxin II [57334] (2 species)
  7. 143504Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)
  8. 143507Domain d1ffja_: 1ffj A: [44441]

Details for d1ffja_

PDB Entry: 1ffj (more details)

PDB Description: nmr structure of cardiotoxin in dpc-micelle

SCOP Domain Sequences for d1ffja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffja_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana)}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

SCOP Domain Coordinates for d1ffja_:

Click to download the PDB-style file with coordinates for d1ffja_.
(The format of our PDB-style files is described here.)

Timeline for d1ffja_: