Lineage for d1ffja_ (1ffj A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032203Protein Cardiotoxin II [57334] (2 species)
  7. 3032204Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)
  8. 3032207Domain d1ffja_: 1ffj A: [44441]
    solution structure in dpc-micelle

Details for d1ffja_

PDB Entry: 1ffj (more details)

PDB Description: nmr structure of cardiotoxin in dpc-micelle
PDB Compounds: (A:) cytotoxin 2

SCOPe Domain Sequences for d1ffja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffja_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana) [TaxId: 8657]}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

SCOPe Domain Coordinates for d1ffja_:

Click to download the PDB-style file with coordinates for d1ffja_.
(The format of our PDB-style files is described here.)

Timeline for d1ffja_: