PDB entry 1ffj

View 1ffj on RCSB PDB site
Description: nmr structure of cardiotoxin in dpc-micelle
Deposited on 2000-07-25, released 2001-01-17
The last revision prior to the SCOP 1.59 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ffja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ffjA (A:)
    lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn