SCOPe 2.02: Domain d1bxpa_: 1bxp A:

Lineage for d1bxpa_ (1bxp A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)

6. Protein Bungarotoxin [57324] (4 species)

7. Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (22 PDB entries)

8. Domain d1bxpa_: 1bxp A: [44428]

Details for d1bxpa_

PDB Entry: 1bxp

PDB Description: solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures

PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d1bxpa_:

Sequence; same for both SEQRES and ATOM records:

>d1bxpa_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

Timeline for d1bxpa_:

• d1bxpa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxpa_ appears in SCOPe 2.01
  
• d1bxpa_ appears in SCOPe 2.03
  
• d1bxpa_ appears in the current release, SCOPe 2.08