Lineage for d1bxpa_ (1bxp A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583549Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2583580Protein Bungarotoxin [57324] (4 species)
  7. 2583581Species Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId:8616] [57325] (26 PDB entries)
  8. 2583601Domain d1bxpa_: 1bxp A: [44428]

Details for d1bxpa_

PDB Entry: 1bxp (more details)

PDB Description: solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures
PDB Compounds: (A:) alpha-bungarotoxin

SCOPe Domain Sequences for d1bxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxpa_ g.7.1.1 (A:) Bungarotoxin {Many-banded krait (Bungarus multicinctus), Alpha-bungarotoxin [TaxId: 8616]}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOPe Domain Coordinates for d1bxpa_:

Click to download the PDB-style file with coordinates for d1bxpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bxpa_: