Lineage for d1bxpa_ (1bxp A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40269Protein Bungarotoxin [57324] (3 species)
  7. 40270Species Alpha-bungarotoxin (Bungarus multicinctus) [57325] (6 PDB entries)
  8. 40275Domain d1bxpa_: 1bxp A: [44428]

Details for d1bxpa_

PDB Entry: 1bxp (more details)

PDB Description: solution nmr structure of the complex of alpha-bungarotoxin with a library derived peptide, 20 structures

SCOP Domain Sequences for d1bxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxpa_ g.7.1.1 (A:) Bungarotoxin {Alpha-bungarotoxin (Bungarus multicinctus)}
ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
stdkcnphpkqrpg

SCOP Domain Coordinates for d1bxpa_:

Click to download the PDB-style file with coordinates for d1bxpa_.
(The format of our PDB-style files is described here.)

Timeline for d1bxpa_: