Lineage for d1fas__ (1fas -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40340Protein Fasciculin [57308] (1 species)
  7. 40341Species Green mamba (Dendroaspis angusticeps) [TaxId:8618] [57309] (7 PDB entries)
  8. 40342Domain d1fas__: 1fas - [44403]

Details for d1fas__

PDB Entry: 1fas (more details), 1.8 Å

PDB Description: 1.9 angstrom resolution structure of fasciculin 1, an anti- acetylcholinesterase toxin from green mamba snake venom

SCOP Domain Sequences for d1fas__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fas__ g.7.1.1 (-) Fasciculin {Green mamba (Dendroaspis angusticeps)}
tmcyshtttsrailtncgenscyrksrrhppkmvlgrgcgcppgddylevkcctspdkcn
y

SCOP Domain Coordinates for d1fas__:

Click to download the PDB-style file with coordinates for d1fas__.
(The format of our PDB-style files is described here.)

Timeline for d1fas__: