Lineage for d1tgxc_ (1tgx C:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40256Family g.7.1.1: Snake venom toxins [57303] (21 proteins)
  6. 40352Protein gamma-Cardiotoxin [57306] (1 species)
  7. 40353Species Snake (Naja nigricollis) [TaxId:8654] [57307] (3 PDB entries)
  8. 40356Domain d1tgxc_: 1tgx C: [44400]

Details for d1tgxc_

PDB Entry: 1tgx (more details), 1.55 Å

PDB Description: x-ray structure at 1.55 a of toxin gamma, a cardiotoxin from naja nigricollis venom. crystal packing reveals a model for insertion into membranes

SCOP Domain Sequences for d1tgxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgxc_ g.7.1.1 (C:) gamma-Cardiotoxin {Snake (Naja nigricollis)}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn

SCOP Domain Coordinates for d1tgxc_:

Click to download the PDB-style file with coordinates for d1tgxc_.
(The format of our PDB-style files is described here.)

Timeline for d1tgxc_: