SCOP 1.55: Domain d2hir__: 2hir -

Lineage for d2hir__ (2hir -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families)

5. Family g.3.15.2: Hirudin-like [57270] (3 proteins)

6. Protein Hirudin [57271] (1 species)

7. Species Leech (Hirudo medicinalis) [TaxId:6421] [57272] (8 PDB entries)

8. Domain d2hir__: 2hir - [44372]

Details for d2hir__

PDB Entry: 2hir

PDB Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study

SCOP Domain Sequences for d2hir__:

Sequence; same for both SEQRES and ATOM records:

>d2hir__ g.3.15.2 (-) Hirudin {Leech (Hirudo medicinalis)}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpq

Timeline for d2hir__:

• d2hir__ appears in SCOP 1.57
  
• d2hir__ appears in the current release, SCOPe 2.08, called d2hira_