Lineage for d2hir__ (2hir -)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 40181Superfamily g.3.15: Leech antihemostatic proteins [57262] (2 families) (S)
  5. 40202Family g.3.15.2: Hirudin-like [57270] (3 proteins)
  6. 40211Protein Hirudin [57271] (1 species)
  7. 40212Species Leech (Hirudo medicinalis) [TaxId:6421] [57272] (8 PDB entries)
  8. 40217Domain d2hir__: 2hir - [44372]

Details for d2hir__

PDB Entry: 2hir (more details)

PDB Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study

SCOP Domain Sequences for d2hir__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hir__ g.3.15.2 (-) Hirudin {Leech (Hirudo medicinalis)}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpq

SCOP Domain Coordinates for d2hir__:

Click to download the PDB-style file with coordinates for d2hir__.
(The format of our PDB-style files is described here.)

Timeline for d2hir__: