SCOPe 2.08: Domain d1pbib_: 1pbi B:

Lineage for d1pbib_ (1pbi B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Pea (Pisum sativum) [TaxId:3888] [57252] (1 PDB entry)

8. Domain d1pbib_: 1pbi B: [44347]

Details for d1pbib_

PDB Entry: 1pbi, 2.7 Å

PDB Description: crystal structure of a bowman-birk inhibitor from pea seeds

PDB Compounds: (B:) bowman-birk proteinase inhibitor

SCOPe Domain Sequences for d1pbib_:

Sequence; same for both SEQRES and ATOM records:

>d1pbib_ g.3.13.1 (B:) Bowman-Birk inhibitor, BBI {Pea (Pisum sativum) [TaxId: 3888]}
ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
eleevikn

Timeline for d1pbib_:

• d1pbib_ first appeared (with stable ids) in SCOP 1.55
  
• d1pbib_ appears in SCOPe 2.07