PDB entry 1pbi

View 1pbi on RCSB PDB site
Description: crystal structure of a bowman-birk inhibitor from pea seeds
Class: bowman-birk inhibitor
Keywords: bowman-birk inhibitor, trypsin inhibitor, chymotrypsin inhibitor
Deposited on 1998-08-20, released 1999-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bowman-birk proteinase inhibitor
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56679 (Start-71)
      • conflict (59)
    Domains in SCOPe 2.08: d1pbia_
  • Chain 'B':
    Compound: bowman-birk proteinase inhibitor
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56679 (Start-71)
      • conflict (59)
    Domains in SCOPe 2.08: d1pbib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pbiA (A:)
    gddvksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykq
    chnseleevikn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbiA (A:)
    ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
    eleevikn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pbiB (B:)
    gddvksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykq
    chnseleevikn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pbiB (B:)
    ksaccdtclctksnpptcrcvdvgetchsaclscicaysnppkcqcfdtqkfcykqchns
    eleevikn