Lineage for d1b9wa2 (1b9w A:46-89)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 40137Family g.3.11.4: Merozoite surface protein 1 (MSP-1) [57239] (1 protein)
  6. 40138Protein Merozoite surface protein 1 (MSP-1) [57240] (2 species)
  7. 40139Species Plasmodium cynomolgi [TaxId:5827] [57241] (1 PDB entry)
  8. 40141Domain d1b9wa2: 1b9w A:46-89 [44335]

Details for d1b9wa2

PDB Entry: 1b9w (more details), 1.8 Å

PDB Description: c-terminal merozoite surface protein 1 from plasmodium cynomolgi

SCOP Domain Sequences for d1b9wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b9wa2 g.3.11.4 (A:46-89) Merozoite surface protein 1 (MSP-1) {Plasmodium cynomolgi}
nmtckdknggcapeaeckmndkneivckctkegseplfegvfcs

SCOP Domain Coordinates for d1b9wa2:

Click to download the PDB-style file with coordinates for d1b9wa2.
(The format of our PDB-style files is described here.)

Timeline for d1b9wa2:

40141
d1b9wa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1b9wa1