Lineage for d1whea1 (1whe A:47-86)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. Protein Factor X, N-terminal module [57205] (2 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [57207] (5 PDB entries)
  8. Domain d1whea1: 1whe A:47-86 [44242]
    Other proteins in same PDB: d1whea2

Details for d1whea1

PDB Entry: 1whe (more details)

PDB Description: coagulation factor, nmr, 20 structures
PDB Compounds: (A:) coagulation factor x

SCOPe Domain Sequences for d1whea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whea1 g.3.11.1 (A:47-86) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]}
gdqceghpclnqghckdgigdytctcaegfegkncefstr

SCOPe Domain Coordinates for d1whea1 are not available.

Timeline for d1whea1:

Domains from same chain:
(mouse over for more information)
d1whea2