Lineage for d1esl_2 (1esl 119-157)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (6 families) 
Family g.3.11.1: EGF-type module [57197] (17 proteins) 
Protein E-selectin, EGF-domain [57203] (1 species) Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) 
Domain d1esl_2: 1esl 119-157 [44225]
Other proteins in same PDB: d1esl_1
Details for d1esl_2
PDB Entry: 1esl (more details), 2 Å
PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains
SCOP Domain Sequences for d1esl_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esl_2 g.3.11.1 (119-157) E-selectin, EGF-domain {Human (Homo sapiens)}
taactntscsghgecvetinnytckcdpgfsglkceqiv
SCOP Domain Coordinates for d1esl_2:
Click to download the PDB-style file with coordinates for d1esl_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1esl_2:
- d1esl_2 first appeared (with stable ids) in SCOP 1.55
- d1esl_2 appears in SCOP 1.57
- d1esl_2 appears in SCOP 1.61
- d1esl_2 appears in the current release, SCOPe 2.08, called d1esla2
View in 3D
