Lineage for d1esl_2 (1esl 119-157)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 39579Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)
  4. 39963Superfamily g.3.11: EGF/Laminin [57196] (4 families) (S)
  5. 39964Family g.3.11.1: EGF-type module [57197] (16 proteins)
  6. 39990Protein E-selectin, EGF-domain [57203] (1 species)
  7. 39991Species Human (Homo sapiens) [TaxId:9606] [57204] (1 PDB entry)
  8. 39992Domain d1esl_2: 1esl 119-157 [44225]
    Other proteins in same PDB: d1esl_1

Details for d1esl_2

PDB Entry: 1esl (more details), 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains

SCOP Domain Sequences for d1esl_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esl_2 g.3.11.1 (119-157) E-selectin, EGF-domain {Human (Homo sapiens)}
taactntscsghgecvetinnytckcdpgfsglkceqiv

SCOP Domain Coordinates for d1esl_2:

Click to download the PDB-style file with coordinates for d1esl_2.
(The format of our PDB-style files is described here.)

Timeline for d1esl_2:

39992
d1esl_2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1esl_1