SCOPe 2.08: Domain d1esla2: 1esl A:119-157

Lineage for d1esla2 (1esl A:119-157)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein E-selectin, EGF-domain [57203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)

8. Domain d1esla2: 1esl A:119-157 [44225]
   Other proteins in same PDB: d1esla1
   complexed with ca, cl

Details for d1esla2

PDB Entry: 1esl, 2 Å

PDB Description: insight into e-selectin(slash)ligand interaction from the crystal structure and mutagenesis of the lec(slash)egf domains

PDB Compounds: (A:) human e-selectin

SCOPe Domain Sequences for d1esla2:

Sequence; same for both SEQRES and ATOM records:

>d1esla2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
taactntscsghgecvetinnytckcdpgfsglkceqiv

Timeline for d1esla2:

• d1esla2 first appeared (with stable ids) in SCOP 1.55, called d1esl_2
  
• d1esla2 appears in SCOPe 2.07