SCOPe 2.01: Domain d1ahoa_: 1aho A:

Lineage for d1ahoa_ (1aho A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (5 families)

5. Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)

6. Protein Scorpion toxin [57097] (17 species)

7. Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (3 PDB entries)
   Uniprot P01484

8. Domain d1ahoa_: 1aho A: [44127]

Details for d1ahoa_

PDB Entry: 1aho, 0.96 Å

PDB Description: the ab initio structure determination and refinement of a scorpion protein toxin

PDB Compounds: (A:) toxin II

SCOPe Domain Sequences for d1ahoa_:

Sequence; same for both SEQRES and ATOM records:

>d1ahoa_ g.3.7.1 (A:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]}
vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
grch

Timeline for d1ahoa_:

• d1ahoa_ first appeared (with stable ids) in SCOP 1.55, called d1aho__
  
• d1ahoa_ appears in SCOP 1.75
  
• d1ahoa_ appears in SCOPe 2.02
  
• d1ahoa_ appears in the current release, SCOPe 2.08