Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) |
Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins) |
Protein Scorpion toxin [57097] (17 species) |
Species Scorpion (Androctonus australis hector), Toxin II [TaxId:70175] [57102] (3 PDB entries) Uniprot P01484 |
Domain d1ahoa_: 1aho A: [44127] |
PDB Entry: 1aho (more details), 0.96 Å
SCOPe Domain Sequences for d1ahoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahoa_ g.3.7.1 (A:) Scorpion toxin {Scorpion (Androctonus australis hector), Toxin II [TaxId: 70175]} vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp grch
Timeline for d1ahoa_: