Lineage for d1aho__ (1aho -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) Superfamily g.3.7: Scorpion toxin-like [57095] (5 families) 
Family g.3.7.1: Long-chain scorpion toxins [57096] (3 proteins) Protein Scorpion toxin [57097] (13 species) Species Scorpion Androctonus australis hector, Toxin II [57102] (2 PDB entries) 
Domain d1aho__: 1aho - [44127]
Details for d1aho__
PDB Entry: 1aho (more details), 0.96 Å
PDB Description: the ab initio structure determination and refinement of a scorpion protein toxin
SCOP Domain Sequences for d1aho__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aho__ g.3.7.1 (-) Scorpion toxin {Scorpion Androctonus australis hector, Toxin II}
vkdgyivddvnctyfcgrnaycneectklkgesgycqwaspygnacycyklpdhvrtkgp
grch
SCOP Domain Coordinates for d1aho__:
Click to download the PDB-style file with coordinates for d1aho__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aho__:
- d1aho__ appears in SCOP 1.57
- d1aho__ appears in the current release, SCOPe 2.08, called d1ahoa_
View in 3D