Lineage for d1c4ea_ (1c4e A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030262Superfamily g.3.4: Gurmarin-like [57048] (2 families) (S)
  5. 3030263Family g.3.4.1: Gurmarin, a sweet taste-suppressing polypeptide [57049] (1 protein)
    automatically mapped to Pfam PF05980
  6. 3030264Protein Gurmarin, a sweet taste-suppressing polypeptide [57050] (1 species)
  7. 3030265Species Gymnema sylvestre [TaxId:4068] [57051] (3 PDB entries)
  8. 3030267Domain d1c4ea_: 1c4e A: [44080]

Details for d1c4ea_

PDB Entry: 1c4e (more details)

PDB Description: gurmarin from gymnema sylvestre
PDB Compounds: (A:) protein (gurmarin)

SCOPe Domain Sequences for d1c4ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4ea_ g.3.4.1 (A:) Gurmarin, a sweet taste-suppressing polypeptide {Gymnema sylvestre [TaxId: 4068]}
eqcvkkdelcipyyldccepleckkvnwwdhkcig

SCOPe Domain Coordinates for d1c4ea_:

Click to download the PDB-style file with coordinates for d1c4ea_.
(The format of our PDB-style files is described here.)

Timeline for d1c4ea_: