Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.4: Gurmarin-like [57048] (2 families) |
Family g.3.4.1: Gurmarin, a sweet taste-suppressing polypeptide [57049] (1 protein) automatically mapped to Pfam PF05980 |
Protein Gurmarin, a sweet taste-suppressing polypeptide [57050] (1 species) |
Species Gymnema sylvestre [TaxId:4068] [57051] (3 PDB entries) |
Domain d1c4ea_: 1c4e A: [44080] |
PDB Entry: 1c4e (more details)
SCOPe Domain Sequences for d1c4ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c4ea_ g.3.4.1 (A:) Gurmarin, a sweet taste-suppressing polypeptide {Gymnema sylvestre [TaxId: 4068]} eqcvkkdelcipyyldccepleckkvnwwdhkcig
Timeline for d1c4ea_: