PDB entry 1c4e

View 1c4e on RCSB PDB site
Description: gurmarin from gymnema sylvestre
Class: plant protein
Keywords: gurmarin, sweet taste suppression, cystine knot, sweet taste transduction, plant protein
Deposited on 1999-07-27, released 1999-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (gurmarin)
  Species: Gymnema sylvestre [TaxId:4068]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25810 (0-34)
  Domains in SCOPe 2.08: d1c4ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c4eA (A:)
  eqcvkkdelcipyyldccepleckkvnwwdhkcig