Lineage for d6inse_ (6ins E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029819Domain d6inse_: 6ins E: [43974]
    complexed with zn

Details for d6inse_

PDB Entry: 6ins (more details), 2 Å

PDB Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue
PDB Compounds: (E:) insulin

SCOPe Domain Sequences for d6inse_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6inse_ g.1.1.1 (E:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d6inse_:

Click to download the PDB-style file with coordinates for d6inse_.
(The format of our PDB-style files is described here.)

Timeline for d6inse_: