PDB entry 6ins

View 6ins on RCSB PDB site
Description: x-ray analysis of the single chain b29-a1 peptide-linked insulin molecule. a completely inactive analogue
Class: hormone
Keywords: hormone
Deposited on 1992-11-25, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'E':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315
  Domains in SCOPe 2.08: d6inse_
• Chain 'F':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315
  Domains in SCOPe 2.08: d6insf_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6insE (E:)
  fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6insF (F:)
  fvnqhlcgshlvealylvcgergffytpkgiveqcctsicslyqlenycn