Lineage for d1izb.1 (1izb B:,A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029616Protein Insulin [56996] (3 species)
  7. 3029784Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries)
  8. 3029814Domain d1izb.1: 1izb B:,A: [43971]
    complexed with zn; mutant

Details for d1izb.1

PDB Entry: 1izb (more details), 2 Å

PDB Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
PDB Compounds: (A:) insulin, (B:) insulin

SCOPe Domain Sequences for d1izb.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1izb.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]}
fvnqhlcgshlvqalylvcgergffytpktXgiveqcctsicslyqlenycn

SCOPe Domain Coordinates for d1izb.1:

Click to download the PDB-style file with coordinates for d1izb.1.
(The format of our PDB-style files is described here.)

Timeline for d1izb.1: