Class g: Small proteins [56992] (100 folds) |
Fold g.1: Insulin-like [56993] (1 superfamily) nearly all-alpha can be classified as disulfide-rich |
Superfamily g.1.1: Insulin-like [56994] (1 family) |
Family g.1.1.1: Insulin-like [56995] (5 proteins) |
Protein Insulin [56996] (3 species) |
Species Pig (Sus scrofa) [TaxId:9823] [56999] (26 PDB entries) |
Domain d1izb.1: 1izb B:,A: [43971] complexed with zn; mutant |
PDB Entry: 1izb (more details), 2 Å
SCOPe Domain Sequences for d1izb.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1izb.1 g.1.1.1 (B:,A:) Insulin {Pig (Sus scrofa) [TaxId: 9823]} fvnqhlcgshlvqalylvcgergffytpktXgiveqcctsicslyqlenycn
Timeline for d1izb.1:
View in 3D Domains from other chains: (mouse over for more information) d1izb.2, d1izb.2, d1izb.2, d1izb.2 |