PDB entry 1izb

View 1izb on RCSB PDB site
Description: role of b13 glu in insulin assembly: the hexamer structure of recombinant mutant (b13 glu-> gln) insulin
Class: hormone
Keywords: hormone
Deposited on 1992-10-16, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1izb.1
  • Chain 'B':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01315 (0-28)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d1izb.1
  • Chain 'C':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1izb.2
  • Chain 'D':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01315 (0-28)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d1izb.2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izbA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izbB (B:)
    fvnqhlcgshlvqalylvcgergffytpkt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izbC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1izbD (D:)
    fvnqhlcgshlvqalylvcgergffytpkt