Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.3: Cytochrome c oxidase-like [56883] (2 proteins) |
Protein Ubiquinol oxidase [56888] (1 species) |
Species Escherichia coli [TaxId:562] [56889] (1 PDB entry) |
Domain d1fftb2: 1fft B:27-117 [43628] Other proteins in same PDB: d1fftb1, d1fftg1 |
PDB Entry: 1fft (more details)
SCOP Domain Sequences for d1fftb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fftb2 f.2.1.3 (B:27-117) Ubiquinol oxidase {Escherichia coli} salldpkgqigleqrsliltafglmlivvipailmavgfawkyrasnkdakyspnwshsn kveavvwtvpiliiiflavltwktthaleps
Timeline for d1fftb2: