Lineage for d1fftg1 (1fft G:118-283)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 11128Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)
  6. 11156Protein Quinol oxidase (CyoA) [49542] (1 species)
  7. 11157Species Escherichia coli [TaxId:562] [49543] (3 PDB entries)
  8. 11161Domain d1fftg1: 1fft G:118-283 [23026]
    Other proteins in same PDB: d1ffta1, d1fftb2, d1fftc1, d1fftf1, d1fftg2, d1ffth1

Details for d1fftg1

PDB Entry: 1fft (more details)

PDB Description: the structure of ubiquinol oxidase from escherichia coli

SCOP Domain Sequences for d1fftg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fftg1 b.6.1.2 (G:118-283) Quinol oxidase (CyoA) {Escherichia coli}
kplahdekpitievvsmdwkwffiypeqgiatvneiafpantpvyfkvtsnsvmnsffip
rlgsqiyamagmqtrlhlianepgtydgisasysgpgfsgmkfkaiatpdraafdqwvak
akqspntmsdmaafeklaapseynqveyfsnvkpdlfadvinkfma

SCOP Domain Coordinates for d1fftg1:

Click to download the PDB-style file with coordinates for d1fftg1.
(The format of our PDB-style files is described here.)

Timeline for d1fftg1: