| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
| Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
| Protein M (medium) subunit [81481] (4 species) |
| Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries) |
| Domain d7prcm_: 7prc M: [43453] Other proteins in same PDB: d7prcc_, d7prch1, d7prch2, d7prch3, d7prcl_ complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4 |
PDB Entry: 7prc (more details), 2.65 Å
SCOPe Domain Sequences for d7prcm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk
Timeline for d7prcm_: