Lineage for d7prcm1 (7prc M:)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38873Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 38874Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 38936Species Rhodopseudomonas viridis [TaxId:1079] [56880] (8 PDB entries)
  8. 38960Domain d7prcm1: 7prc M: [43453]
    Other proteins in same PDB: d7prcc_, d7prch1

Details for d7prcm1

PDB Entry: 7prc (more details), 2.65 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (dg-420315 (triazine) complex)

SCOP Domain Sequences for d7prcm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prcm1 f.2.1.2 (M:) Photosynthetic reaction centre, L-, M- and H-chains {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOP Domain Coordinates for d7prcm1:

Click to download the PDB-style file with coordinates for d7prcm1.
(The format of our PDB-style files is described here.)

Timeline for d7prcm1: