Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d7prch1 (7prc H:37-258)

  1. Root: SCOP 1.75B
  2. Class b: All beta proteins [48724] (174 folds)
  3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. Protein Photosynthetic reaction centre [50348] (3 species)
  7. Species Rhodopseudomonas viridis [TaxId:1079] [50349] (11 PDB entries)
  8. Domain d7prch1: 7prc H:37-258 [25463]
    Other proteins in same PDB: d7prcc_, d7prch2, d7prcl_, d7prcm_
    complexed with bcb, bpb, cet, fe2, hem, lda, mq7, ns5, so4

Details for d7prch1

PDB Entry: 7prc (more details)
PDB Description: photosynthetic reaction center from rhodopseudomonas viridis 420315 (triazine) complex)
PDB Compounds: (H:) photosynthetic reaction center

SCOP Domain Sequences for d7prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOP Domain Coordinates for d7prch1:

Click to download the PDB-style file with coordinates for d7prch1.
(The format of our PDB-style files is described here.)

Timeline for d7prch1:

d7prch1 appears in SCOP 1.75A


d7prch1
(click for larger image)


d7prch1 in context of chain
Domains from same chain:
d7prch2


d7prch1 in context of PDB
Domains from other chains:
d7prcc_, d7prcl_, d7prcm_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu