SCOP 1.63: Domain d5prcm_: 5prc M:

Lineage for d5prcm_ (5prc M:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81478] (8 PDB entries)

8. Domain d5prcm_: 5prc M: [43441]
   Other proteins in same PDB: d5prcc_, d5prch1, d5prch2, d5prcl_
   complexed with 7mq, atz, bcb, bpb, fe2, hem, lda, ns5, so4

Details for d5prcm_

PDB Entry: 5prc, 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

SCOP Domain Sequences for d5prcm_:

Sequence; same for both SEQRES and ATOM records:

>d5prcm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

Timeline for d5prcm_:

• d5prcm_ first appeared (with stable ids) in SCOP 1.55, called d5prcm1
  
• d5prcm_ was called d5prcm1 in SCOP 1.61
  
• d5prcm_ appears in SCOP 1.65
  
• d5prcm_ appears in the current release, SCOPe 2.08