Lineage for d5prch2 (5prc H:1-36)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268041Fold f.23: Single transmembrane helix [81407] (22 superfamilies)
    not a true fold
  4. 268155Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (1 family) (S)
  5. 268156Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 268157Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)
  7. 268194Species Rhodopseudomonas viridis [TaxId:1079] [81485] (8 PDB entries)
  8. 268199Domain d5prch2: 5prc H:1-36 [43442]
    Other proteins in same PDB: d5prcc_, d5prch1, d5prcl_, d5prcm_
    complexed with 7mq, atz, bcb, bpb, fe2, hem, lda, ns5, so4

Details for d5prch2

PDB Entry: 5prc (more details), 2.35 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (atrazine complex)

SCOP Domain Sequences for d5prch2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5prch2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOP Domain Coordinates for d5prch2:

Click to download the PDB-style file with coordinates for d5prch2.
(The format of our PDB-style files is described here.)

Timeline for d5prch2: