Lineage for d1bxla_ (1bxl A:)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1955193Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 1955265Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 1955266Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 1955272Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 1955273Species Human (Homo sapiens) [TaxId:9606] [56857] (32 PDB entries)
  8. 1955316Domain d1bxla_: 1bxl A: [43396]

Details for d1bxla_

PDB Entry: 1bxl (more details)

PDB Description: structure of bcl-xl/bak peptide complex, nmr, minimized average structure
PDB Compounds: (A:) bcl-xl

SCOPe Domain Sequences for d1bxla_:

Sequence, based on SEQRES records: (download)

>d1bxla_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnps
whladspavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitp
gtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylnd
hlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhhh

Sequence, based on observed residues (ATOM records): (download)

>d1bxla_ f.1.4.1 (A:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msmamsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagde
felryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvd
kemqvlvsriaawmatylndhlepwiqenggwdtfvelygnnaaaesrkgqerlehhhhh
h

SCOPe Domain Coordinates for d1bxla_:

Click to download the PDB-style file with coordinates for d1bxla_.
(The format of our PDB-style files is described here.)

Timeline for d1bxla_: