Lineage for d1cnqa_ (1cnq A:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) 
Fold e.7: Sugar phosphatases [56654] (1 superfamily) Superfamily e.7.1: Sugar phosphatases [56655] (1 family) 
Family e.7.1.1: Sugar phosphatases [56656] (5 proteins) 
Protein Fructose-1,6-bisphosphatase [56657] (5 species) Species Pig (Sus scrofa) [TaxId:9823] [56658] (31 PDB entries) 
Domain d1cnqa_: 1cnq A: [42879]
Details for d1cnqa_
PDB Entry: 1cnq (more details), 2.27 Å
PDB Description: fructose-1,6-bisphosphatase complexed with fructose-6-phosphate and zinc ions
SCOP Domain Sequences for d1cnqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cnqa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa)}
fdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnv
tgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssn
idclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfm
ldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryv
gsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldi
vptdihqrapiilgspedvtelleiyqkhaak
SCOP Domain Coordinates for d1cnqa_:
Click to download the PDB-style file with coordinates for d1cnqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cnqa_:
- d1cnqa_ appears in SCOP 1.57
- d1cnqa_ appears in the current release, SCOPe 2.08
View in 3D