Lineage for d1cnqa_ (1cnq A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 38091Fold e.7: Sugar phosphatases [56654] (1 superfamily)
  4. 38092Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 38093Family e.7.1.1: Sugar phosphatases [56656] (5 proteins)
  6. 38101Protein Fructose-1,6-bisphosphatase [56657] (5 species)
  7. 38120Species Pig (Sus scrofa) [TaxId:9823] [56658] (31 PDB entries)
  8. 38125Domain d1cnqa_: 1cnq A: [42879]

Details for d1cnqa_

PDB Entry: 1cnq (more details), 2.27 Å

PDB Description: fructose-1,6-bisphosphatase complexed with fructose-6-phosphate and zinc ions

SCOP Domain Sequences for d1cnqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnqa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa)}
fdtnivtltrfvmeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnv
tgdqvkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssn
idclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfm
ldpaigefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryv
gsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldi
vptdihqrapiilgspedvtelleiyqkhaak

SCOP Domain Coordinates for d1cnqa_:

Click to download the PDB-style file with coordinates for d1cnqa_.
(The format of our PDB-style files is described here.)

Timeline for d1cnqa_: