Lineage for d1gghd2 (1ggh D:27-597)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2570066Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 2570067Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 2570068Family e.5.1.1: Heme-dependent catalases [56635] (3 protein domains)
  6. 2570157Protein Catalase II [56642] (1 species)
    contains additional flavodoxin-like domain at C-terminus
  7. 2570158Species Escherichia coli, HPII [TaxId:562] [56643] (17 PDB entries)
  8. 2570198Domain d1gghd2: 1ggh D:27-597 [42842]
    Other proteins in same PDB: d1ggha1, d1gghb1, d1gghc1, d1gghd1
    complexed with hem

Details for d1gghd2

PDB Entry: 1ggh (more details), 2.15 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, his128ala variant.
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d1gghd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gghd2 e.5.1.1 (D:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]}
dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
riaddqnslragsrgptlledfilrekithfdheriperivaargsaahgyfqpykslsd
itkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpif
fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
tddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d1gghd2:

Click to download the PDB-style file with coordinates for d1gghd2.
(The format of our PDB-style files is described here.)

Timeline for d1gghd2: