PDB entry 1ggh

View 1ggh on RCSB PDB site
Description: crystal structure of catalase hpii from escherichia coli, his128ala variant.
Class: oxidoreductase
Keywords: beta barrel, alpha helical domain, flavodoxin like domain, oxidoreductase
Deposited on 2000-08-21, released 2000-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.161
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered (127)
    Domains in SCOPe 2.07: d1ggha1, d1ggha2
  • Chain 'B':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered (127)
    Domains in SCOPe 2.07: d1gghb1, d1gghb2
  • Chain 'C':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered (127)
    Domains in SCOPe 2.07: d1gghc1, d1gghc2
  • Chain 'D':
    Compound: catalase hpii
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21179 (Start-752)
      • engineered (127)
    Domains in SCOPe 2.07: d1gghd1, d1gghd2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gghA (A:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivaargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gghA (A:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivaargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gghB (B:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivaargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gghB (B:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivaargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gghC (C:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivaargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gghC (C:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivaargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gghD (D:)
    msqhneknphqhqsplhdsseakpgmdslapedgshrpaaeptppgaqptapgslkapdt
    rneklnsledvrkgsenyalttnqgvriaddqnslragsrgptlledfilrekithfdhe
    riperivaargsaahgyfqpykslsditkadflsdpnkitpvfvrfstvqggagsadtvr
    dirgfatkfyteegifdlvgnntpiffiqdahkfpdfvhavkpephwaipqgqsahdtfw
    dyvslqpetlhnvmwamsdrgiprsyrtmegfgihtfrlinaegkatfvrfhwkplagka
    slvwdeaqkltgrdpdfhrrelweaieagdfpeyelgfqlipeedefkfdfdlldptkli
    peelvpvqrvgkmvlnrnpdnffaeneqaafhpghivpgldftndpllqgrlfsytdtqi
    srlggpnfheipinrptcpyhnfqrdgmhrmgidtnpanyepnsindnwpretppgpkrg
    gfesyqervegnkvrerspsfgeyyshprlfwlsqtpfeqrhivdgfsfelskvvrpyir
    ervvdqlahidltlaqavaknlgieltddqlnitpppdvnglkkdpslslyaipdgdvkg
    rvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfagapsl
    tvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeegive
    adsadgsfmdelltlmaahrvwsripkidkipa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gghD (D:)
    dslapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgv
    riaddqnslragsrgptlledfilrekithfdheriperivaargsaahgyfqpykslsd
    itkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpif
    fiqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsy
    rtmegfgihtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweai
    eagdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaen
    eqaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrd
    gmhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyys
    hprlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgiel
    tddqlnitpppdvnglkkdpslslyaipdgdvkgrvvaillndevrsadllailkalkak
    gvhakllysrmgevtaddgtvlpiaatfagapsltvdavivpcgniadiadngdanyylm
    eaykhlkpialagdarkfkatikiadqgeegiveadsadgsfmdelltlmaahrvwsrip
    kidkipa