SCOPe 2.08: Domain d1gghb1: 1ggh B:598-753

Lineage for d1gghb1 (1ggh B:598-753)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.3: Catalase, C-terminal domain [52328] (1 protein)

6. Protein Catalase, C-terminal domain [52329] (2 species)

7. Species Escherichia coli, HPII [TaxId:562] [52330] (17 PDB entries)

8. Domain d1gghb1: 1ggh B:598-753 [31466]
   Other proteins in same PDB: d1ggha2, d1gghb2, d1gghc2, d1gghd2
   complexed with hem

Details for d1gghb1

PDB Entry: 1ggh, 2.15 Å

PDB Description: crystal structure of catalase hpii from escherichia coli, his128ala variant.

PDB Compounds: (B:) catalase hpii

SCOPe Domain Sequences for d1gghb1:

Sequence; same for both SEQRES and ATOM records:

>d1gghb1 c.23.16.3 (B:598-753) Catalase, C-terminal domain {Escherichia coli, HPII [TaxId: 562]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

Timeline for d1gghb1:

• d1gghb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gghb1 appears in SCOPe 2.07