Lineage for d1ewzb_ (1ewz B:)
- Root: SCOP 1.55
Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins) 
Protein OXA-10 beta-lactamase, class D [56622] (1 species) Species Pseudomonas aeruginosa [TaxId:287] [56623] (4 PDB entries) 
Domain d1ewzb_: 1ewz B: [42766]
Details for d1ewzb_
PDB Entry: 1ewz (more details), 2.4 Å
PDB Description: crystal structure of the oxa-10 beta-lactamase from pseudomonas aeruginosa
SCOP Domain Sequences for d1ewzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ewzb_ e.3.1.1 (B:) OXA-10 beta-lactamase, class D {Pseudomonas aeruginosa}
itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
gii
SCOP Domain Coordinates for d1ewzb_:
Click to download the PDB-style file with coordinates for d1ewzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ewzb_:
- d1ewzb_ appears in SCOP 1.57
- d1ewzb_ appears in the current release, SCOPe 2.08
View in 3D
