SCOPe 2.08: Domain d1ewza_: 1ewz A:

Lineage for d1ewza_ (1ewz A:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)

8. Domain d1ewza_: 1ewz A: [42765]

Details for d1ewza_

PDB Entry: 1ewz, 2.4 Å

PDB Description: crystal structure of the oxa-10 beta-lactamase from pseudomonas aeruginosa

PDB Compounds: (A:) beta lactamase oxa-10

SCOPe Domain Sequences for d1ewza_:

Sequence; same for both SEQRES and ATOM records:

>d1ewza_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
gii

Timeline for d1ewza_:

• d1ewza_ first appeared (with stable ids) in SCOP 1.55
  
• d1ewza_ appears in SCOPe 2.07