PDB entry 1ewz

View 1ewz on RCSB PDB site
Description: crystal structure of the oxa-10 beta-lactamase from pseudomonas aeruginosa
Class: hydrolase
Keywords: alpha/beta structure, HYDROLASE
Deposited on 2000-04-28, released 2000-11-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewza_
  • Chain 'B':
    Compound: beta lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewzb_
  • Chain 'C':
    Compound: beta lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewzc_
  • Chain 'D':
    Compound: beta lactamase oxa-10
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ewzd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ewzA (A:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewzA (A:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ewzB (B:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewzB (B:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ewzC (C:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewzC (C:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsy
    gnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeyl
    vhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimese
    gii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ewzD (D:)
    sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
    gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
    ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
    lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
    egiigg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ewzD (D:)
    itentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigletg
    viknehqvfkwdgkramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfsyg
    nqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapeylv
    hsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimeseg
    ii