SCOPe 2.08: Domain d1fofb_: 1fof B:

Lineage for d1fofb_ (1fof B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries)

8. Domain d1fofb_: 1fof B: [42764]
   complexed with co, so4

Details for d1fofb_

PDB Entry: 1fof, 2 Å

PDB Description: crystal structure of the class d beta-lactamase oxa-10

PDB Compounds: (B:) beta lactamase oxa-10

SCOPe Domain Sequences for d1fofb_:

Sequence; same for both SEQRES and ATOM records:

>d1fofb_ e.3.1.1 (B:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle
tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf
sygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaape
ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime
segiig

Timeline for d1fofb_:

• d1fofb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fofb_ appears in SCOPe 2.07