Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein Class D beta-lactamase [56622] (4 species) |
Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (36 PDB entries) |
Domain d1fofa_: 1fof A: [42763] complexed with co, so4 |
PDB Entry: 1fof (more details), 2 Å
SCOPe Domain Sequences for d1fofa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fofa_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]} gsitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiigle tgviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkf sygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaape ylvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkime segiig
Timeline for d1fofa_: