Lineage for d1buea_ (1bue A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266203Protein beta-Lactamase, class A [56606] (13 species)
  7. 266215Species Enterobacter cloacae, NMC-A carbapenemase [TaxId:550] [56613] (2 PDB entries)
  8. 266216Domain d1buea_: 1bue A: [42727]

Details for d1buea_

PDB Entry: 1bue (more details), 1.64 Å

PDB Description: nmc-a carbapenemase from enterobacter cloacae

SCOP Domain Sequences for d1buea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1buea_ e.3.1.1 (A:) beta-Lactamase, class A {Enterobacter cloacae, NMC-A carbapenemase}
ntkgideiknletdfngrigvyaldtgsgksfsyranerfplcssfkgflaaavlkgsqd
nrlnlnqivnyntrslefhspittkykdngmslgdmaaaalqysdngatniileryiggp
egmtkfmrsigdedfrldrweldlntaipgderdtstpaavakslktlalgnilseheke
tyqtwlkgnttgaarirasvpsdwvvgdktgscgaygtandyavvwpknrapliisvytt
knekeakhedkviaeasriaidnlk

SCOP Domain Coordinates for d1buea_:

Click to download the PDB-style file with coordinates for d1buea_.
(The format of our PDB-style files is described here.)

Timeline for d1buea_: