![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein beta-Lactamase, class A [56606] (16 species) |
![]() | Species Enterobacter cloacae, NMC-A carbapenemase [TaxId:550] [56613] (2 PDB entries) |
![]() | Domain d1buea_: 1bue A: [42727] |
PDB Entry: 1bue (more details), 1.64 Å
SCOPe Domain Sequences for d1buea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1buea_ e.3.1.1 (A:) beta-Lactamase, class A {Enterobacter cloacae, NMC-A carbapenemase [TaxId: 550]} ntkgideiknletdfngrigvyaldtgsgksfsyranerfplcssfkgflaaavlkgsqd nrlnlnqivnyntrslefhspittkykdngmslgdmaaaalqysdngatniileryiggp egmtkfmrsigdedfrldrweldlntaipgderdtstpaavakslktlalgnilseheke tyqtwlkgnttgaarirasvpsdwvvgdktgscgaygtandyavvwpknrapliisvytt knekeakhedkviaeasriaidnlk
Timeline for d1buea_: