Lineage for d1kge__ (1kge -)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 423760Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 423761Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 423762Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (10 proteins)
  6. 423845Protein beta-Lactamase, class A [56606] (15 species)
  7. 423924Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)
  8. 423928Domain d1kge__: 1kge - [42708]
    mutant

Details for d1kge__

PDB Entry: 1kge (more details), 2 Å

PDB Description: structure of beta-lactamase asn 170 met mutant

SCOP Domain Sequences for d1kge__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kge__ e.3.1.1 (-) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielmyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

SCOP Domain Coordinates for d1kge__:

Click to download the PDB-style file with coordinates for d1kge__.
(The format of our PDB-style files is described here.)

Timeline for d1kge__: