SCOP 1.65: Domain d1kge__: 1kge -

Lineage for d1kge__ (1kge -)

1. Root: SCOP 1.65

2. Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)

6. Protein beta-Lactamase, class A [56606] (14 species)

7. Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries)

8. Domain d1kge__: 1kge - [42708]
   mutant

Details for d1kge__

PDB Entry: 1kge, 2 Å

PDB Description: structure of beta-lactamase asn 170 met mutant

SCOP Domain Sequences for d1kge__:

Sequence; same for both SEQRES and ATOM records:

>d1kge__ e.3.1.1 (-) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielmyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef

Timeline for d1kge__:

• d1kge__ first appeared (with stable ids) in SCOP 1.55
  
• d1kge__ appears in SCOP 1.63
  
• d1kge__ appears in SCOP 1.67
  
• d1kge__ appears in the current release, SCOPe 2.08, called d1kgea_