Lineage for d1erqa_ (1erq A:)

  1. Root: SCOP 1.55
  2. 37754Class e: Multi-domain proteins (alpha and beta) [56572] (28 folds)
  3. 37843Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 37844Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 37845Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (6 proteins)
  6. 37871Protein beta-Lactamase, class A [56606] (11 species)
  7. 37882Species Escherichia coli, TEM-1 [TaxId:562] [56607] (11 PDB entries)
  8. 37890Domain d1erqa_: 1erq A: [42697]

Details for d1erqa_

PDB Entry: 1erq (more details), 1.9 Å

PDB Description: x-ray crystal structure of tem-1 beta lactamase in complex with a designed boronic acid inhibitor (1r)-1-acetamido-2-(3-carboxy-2-hydroxyphenyl)ethyl boronic acid

SCOP Domain Sequences for d1erqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1erqa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

SCOP Domain Coordinates for d1erqa_:

Click to download the PDB-style file with coordinates for d1erqa_.
(The format of our PDB-style files is described here.)

Timeline for d1erqa_: