Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) |
Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) |
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
Species Pseudomonas mevalonii [TaxId:32044] [56546] (2 PDB entries) |
Domain d1qaxb2: 1qax B:504-610,B:721-875 [42598] Other proteins in same PDB: d1qaxa1, d1qaxb1 |
PDB Entry: 1qax (more details), 2.8 Å
SCOP Domain Sequences for d1qaxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaxb2 d.179.1.1 (B:504-610,B:721-875) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii} dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritpq qletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveagah ayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqa laeiavavglaqnlgamralate
Timeline for d1qaxb2: