Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily) unusual fold |
Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) |
Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein) |
Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries) |
Domain d1dq9a4: 1dq9 A:461-586,A:704-865 [42593] Other proteins in same PDB: d1dq9a1, d1dq9b1, d1dq9c1, d1dq9d1 complexed with hmg |
PDB Entry: 1dq9 (more details), 2.8 Å
SCOPe Domain Sequences for d1dq9a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dq9a4 d.179.1.1 (A:461-586,A:704-865) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]} flsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdynys lvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglgggas srvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaani vtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqqa clqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvks
Timeline for d1dq9a4: